Tag Archives: salad

  Image: Marthastewart.com I had the most delicious chicken salad the other day at a friend’s house after a late morning hike. She is addicted to everything Martha Stewart and got the recipe from the maven’s site, Marthastewart.com. It was … Continue reading

Posted in Remarkable Recipes | Tagged , , , , , , , | Leave a comment

  Image: womansdaymagazine.com While perusing Pinterest, I came across a recipe that is out of this world. I L.O.V.E. caprese salad, but never had a peach caprese salad until I tried this recipe. Whoa! This is the most amazing caprese … Continue reading

Posted in Remarkable Recipes | Tagged , , , , | Leave a comment

Image: twopeasandtheirpod I don’t know about you, but there is only so much salad I can eat before I start to get pretty ho-hum about it. Melissa Costello’s Asian-style quinoa salad is a great recipe to spice up your salad life … Continue reading

Posted in Remarkable Recipes | Tagged , , , , | Leave a comment

Myrecipes.com  Who doesn’t love chicken salad, right? I love adding chicken to my salad because it gives me great protein for the day.  You can prepare the chicken up to 2 days in advance.  Keep it tightly covered in the … Continue reading

Posted in Remarkable Recipes | Tagged , , , | Leave a comment

Pack a Picnic

Image:  livesimplylivethriftylivesavvy.com A picnic is the quintessential essence and Shining Moment of summertime. One of the reasons why I love picnics so much is because you can have them anywhere.  I love nothing more than throwing a blanket down in a back … Continue reading

Posted in Just for Fun | Tagged , , , , , , , , , | Leave a comment